Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 32 (SIM32), partial, Biotinylated

This Recombinant Human Small integral membrane protein 32 (SIM32), partial, Biotinylated spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 32 SMIM32

UniProt

A0A1B0GUA5

Expression Region

1-54

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGDIFNATGGPEAAVGSALAPGATVKAEGALPLELATARGMRDGAATKPDLPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 405)
MBS6195308-01 0.1 mL

EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 405)

Sign In for Pricing
View Details
EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 405)
MBS6195308-02 5x 0.1 mL

EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 405)

Sign In for Pricing
View Details
Interleukin 19 (IL19) Magnetic Fluorescence Assay Kit
MBS2157018-01 96 Tests

Interleukin 19 (IL19) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Interleukin 19 (IL19) Magnetic Fluorescence Assay Kit
MBS2157018-02 5x 96 Tests

Interleukin 19 (IL19) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Interleukin 19 (IL19) Magnetic Fluorescence Assay Kit
MBS2157018-03 10x 96 Tests

Interleukin 19 (IL19) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Lentiviral human CBY2 shRNA (UAS) - Lentiviral human CBY2 shRNA (UAS, RFP) (100)
GTR15321423 1 Vial

Lentiviral human CBY2 shRNA (UAS) - Lentiviral human CBY2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details