Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus OmpA-like transmembrane domain

Product Specifications

Abbreviation

Recombinant Brucella abortus OmpA-like transmembrane domain protein

UniProt

Q2YN33

Expression Region

24-213aa

Organism

Brucella abortus (strain 2308)

Target Sequence

ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2X1 (P2RX1) Human shRNA Plasmid Kit (Locus ID 5023)
TL310650 1 Kit

P2X1 (P2RX1) Human shRNA Plasmid Kit (Locus ID 5023)

Sign In for Pricing
View Details
KIF18B (NM_001080443) Human Untagged Clone
SC315842 10 µg

KIF18B (NM_001080443) Human Untagged Clone

Sign In for Pricing
View Details
UGCGL1, CT (UGGT1, GT, UGCGL1, UGGT, UGT1, UGTR, UDP-glucose:glycoprotein glucosyltransferase 1, UDP-Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1) (Azide free) (HRP)
MBS6361117-01 0.2 mL

UGCGL1, CT (UGGT1, GT, UGCGL1, UGGT, UGT1, UGTR, UDP-glucose:glycoprotein glucosyltransferase 1, UDP-Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1) (Azide free) (HRP)

Sign In for Pricing
View Details
UGCGL1, CT (UGGT1, GT, UGCGL1, UGGT, UGT1, UGTR, UDP-glucose:glycoprotein glucosyltransferase 1, UDP-Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1) (Azide free) (HRP)
MBS6361117-02 5x 0.2 mL

UGCGL1, CT (UGGT1, GT, UGCGL1, UGGT, UGT1, UGTR, UDP-glucose:glycoprotein glucosyltransferase 1, UDP-Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1) (Azide free) (HRP)

Sign In for Pricing
View Details
ELISA Kit for Prolactin (PRL)
TRV-0042558-01 24 Tests

ELISA Kit for Prolactin (PRL)

Sign In for Pricing
View Details
ELISA Kit for Prolactin (PRL)
TRV-0042558-02 48 Tests

ELISA Kit for Prolactin (PRL)

Sign In for Pricing
View Details