Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C19orf85 (CS085), Biotinylated

This Recombinant Human Uncharacterized protein C19orf85 (CS085), Biotinylated spans the amino acid sequence from region 1-222. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C19orf85 C19orf85

UniProt

A0A1B0GUS0

Expression Region

1-222

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MHPGVPEGPGVSEPGPRELCAFVSGAAAHMLRALQPRRTRPPKRRPNHRRFLHNQICRQFTKIEAATQRLALSILSQEAPPQRPSLQKPPPPPPSPFLGVACAVAPTEAPHASASLSLAALDTSTLDLFDNIALTPECASMPWDPSSGSDAPLPAPGLSHRDLGQLDLRQVPHFCGPLPLPQHALGEEADLVAPDWGWVDCWEVPRAWDSQGIPEGWGTSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZH2 (NM_152998) Human Over-expression Lysate
LY430254 100 µg

EZH2 (NM_152998) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Col6a3 activation kit by CRISPRa
GA200823 1 Kit

Mouse Col6a3 activation kit by CRISPRa

Sign In for Pricing
View Details
SMAP2 (NM_001198979) Human Over-expression Lysate
LC434223 20 µg

SMAP2 (NM_001198979) Human Over-expression Lysate

Sign In for Pricing
View Details
Dendrobine
TRC-D231445-10MG 10 mg

Dendrobine

Sign In for Pricing
View Details
2-Pentyl Acetate (>90% purity)
TRC-P276700-250MG 250 mg

2-Pentyl Acetate (>90% purity)

Sign In for Pricing
View Details
Drying Oven BODR-7103
BODR-7103 1 Unit

Drying Oven BODR-7103

Sign In for Pricing
View Details