Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C19orf85 (CS085), Biotinylated

This Recombinant Human Uncharacterized protein C19orf85 (CS085), Biotinylated spans the amino acid sequence from region 1-222. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C19orf85 C19orf85

UniProt

A0A1B0GUS0

Expression Region

1-222

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MHPGVPEGPGVSEPGPRELCAFVSGAAAHMLRALQPRRTRPPKRRPNHRRFLHNQICRQFTKIEAATQRLALSILSQEAPPQRPSLQKPPPPPPSPFLGVACAVAPTEAPHASASLSLAALDTSTLDLFDNIALTPECASMPWDPSSGSDAPLPAPGLSHRDLGQLDLRQVPHFCGPLPLPQHALGEEADLVAPDWGWVDCWEVPRAWDSQGIPEGWGTSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matn4 (NM_013592) Mouse Tagged ORF Clone Lentiviral Particle
MR209522L4V 200 µL

Matn4 (NM_013592) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Escherichia coli Universal stress protein B (uspB)
orb2934023-01 20 µg

Recombinant Escherichia coli Universal stress protein B (uspB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Universal stress protein B (uspB)
orb2934023-02 100 µg

Recombinant Escherichia coli Universal stress protein B (uspB)

Sign In for Pricing
View Details
Lin7c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6911606 1.0 µg DNA

Lin7c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
BCL6 Rabbit Polyclonal Antibody (Carrier-free)
orb3119878 100 µg

BCL6 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
GSTZ1 Antibody
A24100-50UL 50 μL

GSTZ1 Antibody

Sign In for Pricing
View Details