Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf143 (CJ143), Biotinylated

This Recombinant Human Uncharacterized protein C10orf143 (CJ143), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf143 C10orf143

UniProt

A0A1B0GUT2

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDSLALGRWRQRRAEDLQVPGDVKRVCRRLEASGHERGCHQVNACALASWGPEDRELPSRGCLPAPRPESGQGRLSTGISQNGGRSSAQPCPRCIAGESGHFSHTKNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA) (PE)
MBS6129160-01 0.1 mL

Carcinoembryonic Antigen (CEA) (PE)

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) (PE)
MBS6129160-02 5x 0.1 mL

Carcinoembryonic Antigen (CEA) (PE)

Sign In for Pricing
View Details
LY278584 5mg
A15500-5 5 mg

LY278584 5mg

Sign In for Pricing
View Details
SPHK1 Rabbit Polyclonal Antibody (Cy7)
orb1049298 100 µL

SPHK1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1)
036079 200 µL

GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1)

Sign In for Pricing
View Details
3-Oxo-5,6-diphenyl-2,3-dihydropyridazine-4-carboxylic acid
HDA23191-01 0.5 g

3-Oxo-5,6-diphenyl-2,3-dihydropyridazine-4-carboxylic acid

Sign In for Pricing
View Details