Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated

This Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHX2 Mouse Monoclonal Antibody [Clone ID: OTI3D3]
CF810302 100 µg

LHX2 Mouse Monoclonal Antibody [Clone ID: OTI3D3]

Sign In for Pricing
View Details
C2orf16 Antibody
KC-22371-01 50 μL

C2orf16 Antibody

Sign In for Pricing
View Details
C2orf16 Antibody
KC-22371-02 100 µL

C2orf16 Antibody

Sign In for Pricing
View Details
C2orf16 Antibody
KC-22371-03 1 mL

C2orf16 Antibody

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF568 conjugate, 0.1mg/mL
BNC681143-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C17orf85 (NCBP3) activation kit by CRISPRa
GA110747 1 Kit

Human C17orf85 (NCBP3) activation kit by CRISPRa

Sign In for Pricing
View Details