Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated

This Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-D-ser(Ac)-OH
TRC-F620230-250MG 250 mg

Fmoc-D-ser(Ac)-OH

Sign In for Pricing
View Details
SREBP1 (SREBP1/1578), 0.2mg/mL
BNUB1578-100 1x 100 µL

SREBP1 (SREBP1/1578), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Ptdss1 activation kit by CRISPRa
GA203445 1 Kit

Mouse Ptdss1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Fam219a activation kit by CRISPRa
GA209007 1 Kit

Mouse Fam219a activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Prostate
CR561405 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
Slc5a7 Mouse Gene Knockout Kit (CRISPR)
KN516164 1 Kit

Slc5a7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details