Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated

This Recombinant Human Testis-expressed protein 54 (TEX54), Biotinylated spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Bromoguanosine
TRC-B684365-2G 2 g

8-Bromoguanosine

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: right
CP541587 150 µg

Tissue Protein Lysate, Colon: right

Sign In for Pricing
View Details
Ozone UV Sterilization Cabinet BAIP-602
BAIP-602 1 Unit

Ozone UV Sterilization Cabinet BAIP-602

Sign In for Pricing
View Details
CD72 (B Cell Marker) (BU40), CF740 conjugate, 0.1mg/mL
BNC742906-100 1x 100 µL

CD72 (B Cell Marker) (BU40), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TXNL6 (NXNL1) (NM_138454) Human Recombinant Protein
TP304346M 100 µg

TXNL6 (NXNL1) (NM_138454) Human Recombinant Protein

Sign In for Pricing
View Details
LAMA2 Antibody
8C13065-AAT 50 µg

LAMA2 Antibody

Sign In for Pricing
View Details