Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IQ domain-containing protein M (IQCM), Biotinylated

This Recombinant Human IQ domain-containing protein M (IQCM), Biotinylated spans the amino acid sequence from region 1-501. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IQ domain-containing protein M IQCM

UniProt

A0A1B0GVH7

Expression Region

1-501

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTEEAMPEKAKCPTLEITKQDFFQEAKTLIAQHYEKINENKVQGTSINVFRKKHQKPKSGKYIPLEIDKKVTRDVVQEHRAALRRICFPKELSKSEHLQEPPQRISFKEPHIFSRRERCRPIDLITKGQVKLDKIMTIIEPVSKKMETAKQQHFEESRNRMLELLYPFPVHLYLQPGTSNLELLKEPDKAFYDWRGFVLTRSFRLACDSRRVSFSQSSSIFRDYYSKTFKTLIKKERQPIKPEPKSQPRIKGTPNKTDKLDSKVKRIGPHIEIFQVFRERKKFMITPKLIRMVTVMQAHVRGWLERKRLQRVMTKALDHGPDMKAVINMYGRLIHRVRYRRGLWRTRQILNLAELEEWMDRKKFYEIMFAKREDWPKIERNELPNFFSDCGHFPTQKQVDDTWDLVHQDGKEKYSELIKKSKAIEMLFTLYPPEGAHVPDSTLLKSTWLRPIVNGEEGYRYIVNGHPALKRANIRVVGKLVARSIRERKMRQHYKSCKVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC35E4 Antibody Picoband® (Dylight488 Conjugate)
A18522-Dylight488 100 µg

Anti-SLC35E4 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Anti-EWSR1 Antibody Picoband® (Dylight550 Conjugate)
PB9585-Dylight550 100 µg

Anti-EWSR1 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
ANAPC2 (Anaphase-promoting Complex Subunit 2, APC2, Cyclosome Subunit 2, ANAPC2, APC2, KIAA1406) (MaxLight 750)
MBS6454191-01 0.1 mL

ANAPC2 (Anaphase-promoting Complex Subunit 2, APC2, Cyclosome Subunit 2, ANAPC2, APC2, KIAA1406) (MaxLight 750)

Sign In for Pricing
View Details
ANAPC2 (Anaphase-promoting Complex Subunit 2, APC2, Cyclosome Subunit 2, ANAPC2, APC2, KIAA1406) (MaxLight 750)
MBS6454191-02 5x 0.1 mL

ANAPC2 (Anaphase-promoting Complex Subunit 2, APC2, Cyclosome Subunit 2, ANAPC2, APC2, KIAA1406) (MaxLight 750)

Sign In for Pricing
View Details
Nkx 3.1 (NK-2 Family Homeodomain Transcription Factor) discontinued
N2850-30 100 µg

Nkx 3.1 (NK-2 Family Homeodomain Transcription Factor) discontinued

Sign In for Pricing
View Details
DERA (NM_015954) Human Tagged ORF Clone Lentiviral Particle
RC224461L1V 200 µL

DERA (NM_015954) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details