Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog C (ETDC), Biotinylated

This Recombinant Human Embryonic testis differentiation protein homolog C (ETDC), Biotinylated spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog C ETDC

UniProt

A0A1B0GVM5

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKELPKASPSEPALNIKKSGKSFKCKKPTKNVQVFLINRQLGRNRSDTDLSKWLWMLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Toll-like receptor 4, TLR4 ELISA Kit
MBS161614-01 48 Well

Rat Toll-like receptor 4, TLR4 ELISA Kit

Sign In for Pricing
View Details
Rat Toll-like receptor 4, TLR4 ELISA Kit
MBS161614-02 96 Well

Rat Toll-like receptor 4, TLR4 ELISA Kit

Sign In for Pricing
View Details
Rat Toll-like receptor 4, TLR4 ELISA Kit
MBS161614-03 5x 96 Well

Rat Toll-like receptor 4, TLR4 ELISA Kit

Sign In for Pricing
View Details
Rat Toll-like receptor 4, TLR4 ELISA Kit
MBS161614-04 10x 96 Well

Rat Toll-like receptor 4, TLR4 ELISA Kit

Sign In for Pricing
View Details
Mouse Fam98a Pre-designed siRNA Set A
SI104712A 1 Each

Mouse Fam98a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Z-Gly-Gly-Phe-OH
C-1795.0005 5.0g

Z-Gly-Gly-Phe-OH

Sign In for Pricing
View Details