Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 200 (CC200), Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 200 (CC200), Biotinylated spans the amino acid sequence from region 1-168. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 200 CCDC200

UniProt

A0A1B0GVQ3

Expression Region

1-168

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSAYHWEARRRQMALDRRRWLMAQQQQELQQKEQELKNHQEEEQQSEEKLQPHKKLNVPQPPVAKLWTSQEQPQPSQQQPSVQPPSQPPPQPSTLPQAQVWPGPQPPQPQPPPQPTQPSAQARCTQHTSKCNLQDSQRPGLMNPCQSSPIRNTGYSQLKSTNYIQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a29 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3583707 1.0 µg DNA

Slc25a29 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Snapc2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3734404 1.0 µg DNA

Snapc2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Refrigerated Circulator, 28L, Advanced Programmable (-30° to 200°C), 120V, 60Hz
AP28R-30-A11B 1 Each

Refrigerated Circulator, 28L, Advanced Programmable (-30° to 200°C), 120V, 60Hz

Sign In for Pricing
View Details
Luciferase (Luci17)
sc-57604 200 µg/mL

Luciferase (Luci17)

Sign In for Pricing
View Details
RAB3IP Polyclonal Antibody
RD84901A-01 60μL

RAB3IP Polyclonal Antibody

Sign In for Pricing
View Details
RAB3IP Polyclonal Antibody
RD84901A-02 120μL

RAB3IP Polyclonal Antibody

Sign In for Pricing
View Details