Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 200 (CC200), Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 200 (CC200), Biotinylated spans the amino acid sequence from region 1-168. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 200 CCDC200

UniProt

A0A1B0GVQ3

Expression Region

1-168

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSAYHWEARRRQMALDRRRWLMAQQQQELQQKEQELKNHQEEEQQSEEKLQPHKKLNVPQPPVAKLWTSQEQPQPSQQQPSVQPPSQPPPQPSTLPQAQVWPGPQPPQPQPPPQPTQPSAQARCTQHTSKCNLQDSQRPGLMNPCQSSPIRNTGYSQLKSTNYIQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-GAB2 (Ser159) Polyclonal Antibody, Cy5.5 Conjugated
bs-3177R-Cy5.5 100 µL

Phospho-GAB2 (Ser159) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
CXCL13 Rabbit pAb
A15782 500 µL

CXCL13 Rabbit pAb

Sign In for Pricing
View Details
IL17D Antibody : HRP (OAPB00408-HRP)
OAPB00408-100UG-HRP 0.1 mg

IL17D Antibody : HRP (OAPB00408-HRP)

Sign In for Pricing
View Details
Fmoc-Gly-Gly-OH
sc-285743 1 g

Fmoc-Gly-Gly-OH

Sign In for Pricing
View Details
TOP2B Antibody
K70028M09F02C-01 50 ug

TOP2B Antibody

Sign In for Pricing
View Details
TOP2B Antibody
K70028M09F02C-02 100 ug

TOP2B Antibody

Sign In for Pricing
View Details