Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM240C (F240C), Biotinylated

This Recombinant Human Protein FAM240C (F240C), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM240C FAM240C

UniProt

A0A1B0GVR7

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVGKNMSKSLTLKNPGRVAYDSGGIKMFWEKKIEHHARHLQNEDIRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,5-Naphthyridine
orb3029487-01 50 mg

1,5-Naphthyridine

Sign In for Pricing
View Details
1,5-Naphthyridine
orb3029487-02 200 mg

1,5-Naphthyridine

Sign In for Pricing
View Details
Orotic acid
B1147-5.1 10 mM (in 1mL DMSO)

Orotic acid

Sign In for Pricing
View Details
Human NRG4 knockout cell line
ABC-KH10339 1 Vial

Human NRG4 knockout cell line

Sign In for Pricing
View Details
BBS5 Protein Lysate (Human) with C-Ha Tag
13040031 100 µg

BBS5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Anti-SIRP alpha Antibody (PE), Rabbit Monoclonal
MBS8112883-01 25 Tests

Recombinant Anti-SIRP alpha Antibody (PE), Rabbit Monoclonal

Sign In for Pricing
View Details