Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 36 (SIM36), partial, Biotinylated

This Recombinant Human Small integral membrane protein 36 (SIM36), partial, Biotinylated spans the amino acid sequence from region 35-93. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 36 SMIM36

UniProt

A0A1B0GVT2

Expression Region

35-93

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDCRGKDPSKEYAPEATLEAQPSIRLVVMHPSVAGPHWPKGPGLSLGDPAPLGKKSTMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srsf3 sgRNA CRISPR Lentivector set (Rat)
K6758601 3x 1.0 µg

Srsf3 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse COL3a1 (Collagen Type III Alpha 1) ELISA Kit
EK251203 96 Well

Mouse COL3a1 (Collagen Type III Alpha 1) ELISA Kit

Sign In for Pricing
View Details
PPRC1 Rabbit Polyclonal Antibody
orb630180-01 50 µg

PPRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPRC1 Rabbit Polyclonal Antibody
orb630180-02 100 µg

PPRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal E-Cadherin Antibody [Biotin]
NBP2-98433B 0.1 mL

Rabbit Polyclonal E-Cadherin Antibody [Biotin]

Sign In for Pricing
View Details
KRT19 Antibody
K16229U11E05C-01 50 ug

KRT19 Antibody

Sign In for Pricing
View Details