Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM240B (F240B), Biotinylated

This Recombinant Human Protein FAM240B (F240B), Biotinylated spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM240B FAM240B

UniProt

A0A1B0GVZ2

Expression Region

1-78

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNNQYIRREVFCCGTCHELKSFWEKEISKQTFYRELEEDRQERSALKKLREEWRQRLERRLRMLDNPVEKEKPAHTAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK33 Protein Vector (Human) (pPM-C-His)
PV040576 500 ng

STK33 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Picotamide monohydrate
orb3173982-01 10 mg

Picotamide monohydrate

Sign In for Pricing
View Details
Picotamide monohydrate
orb3173982-02 50 mg

Picotamide monohydrate

Sign In for Pricing
View Details
KIF3A, CT (KIF3A, KIF3, Kinesin-like protein KIF3A, Microtubule plus end-directed kinesin motor 3A) (MaxLight 550) discontinued
037441-ML550 100 µL

KIF3A, CT (KIF3A, KIF3, Kinesin-like protein KIF3A, Microtubule plus end-directed kinesin motor 3A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
HSPBAP1 (HSPB1-Associated Protein 1, 27kD Heat Shock Protein-Associated Protein 1, Protein Associated with Small Stress Protein 1, PASS1) (HRP)
319694-01 50 µg

HSPBAP1 (HSPB1-Associated Protein 1, 27kD Heat Shock Protein-Associated Protein 1, Protein Associated with Small Stress Protein 1, PASS1) (HRP)

Sign In for Pricing
View Details
HSPBAP1 (HSPB1-Associated Protein 1, 27kD Heat Shock Protein-Associated Protein 1, Protein Associated with Small Stress Protein 1, PASS1) (HRP)
319694-02 100 µg

HSPBAP1 (HSPB1-Associated Protein 1, 27kD Heat Shock Protein-Associated Protein 1, Protein Associated with Small Stress Protein 1, PASS1) (HRP)

Sign In for Pricing
View Details