Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 269 (TM269), partial, Biotinylated

This Recombinant Human Transmembrane protein 269 (TM269), partial, Biotinylated spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 269 TMEM269

UniProt

A0A1B0GVZ9

Expression Region

1-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVLGLFSIIFSFSRKCHYASRMLLVSFLLDMAVRAMTSHINICSKLGAELNDFAVFTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DREF Antibody (PCRP-ZBED1-1E1) [DyLight 755]
NBP3-08861IR 100 µL

Mouse Monoclonal DREF Antibody (PCRP-ZBED1-1E1) [DyLight 755]

Sign In for Pricing
View Details
Erythrosin B 500mg
A16967-500 500 mg

Erythrosin B 500mg

Sign In for Pricing
View Details
TMEM149 Peptide - N-terminal region
orb2014500 100 µg

TMEM149 Peptide - N-terminal region

Sign In for Pricing
View Details
PARP10 Protein Vector (Mouse) (pPB-C-His)
PV213570 500 ng

PARP10 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GIT1 Rabbit Polyclonal Antibody (Fluoro647)
orb3111576 100 µg

GIT1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Bovine Olfactory receptor 2L13 (OR2L13) ELISA kit
GTR10431621 96 Well

Bovine Olfactory receptor 2L13 (OR2L13) ELISA kit

Sign In for Pricing
View Details