Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8), Biotinylated

This Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombospondin type-1 domain-containing protein 8 THSD8

UniProt

A0A1W2PP97

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ALVYQDYQYLGQQGEGDSWEQLRLQHLKEVEDSILGPWGKWRCLCDLGKQERSREVVGTAPGPVFMDPEKLIQLRPCRQRDCPSCKPFDCDWRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFT2C (SFT2D3) Human siRNA Oligo Duplex (Locus ID 84826)
SR313681 1 Kit

SFT2C (SFT2D3) Human siRNA Oligo Duplex (Locus ID 84826)

Sign In for Pricing
View Details
Rab43 (NM_001039394) Mouse Recombinant Protein
E45M44193M5 20 µg

Rab43 (NM_001039394) Mouse Recombinant Protein

Sign In for Pricing
View Details
RPS4XP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV782251 1.0 µg DNA

RPS4XP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
GAK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV660484 1.0 µg DNA

GAK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
EDA2R, CT (EDA2R, TNFRSF27, XEDAR, Tumor necrosis factor receptor superfamily member 27, X-linked ectodysplasin-A2 receptor) (FITC)
MBS6294316-01 0.2 mL

EDA2R, CT (EDA2R, TNFRSF27, XEDAR, Tumor necrosis factor receptor superfamily member 27, X-linked ectodysplasin-A2 receptor) (FITC)

Sign In for Pricing
View Details
EDA2R, CT (EDA2R, TNFRSF27, XEDAR, Tumor necrosis factor receptor superfamily member 27, X-linked ectodysplasin-A2 receptor) (FITC)
MBS6294316-02 5x 0.2 mL

EDA2R, CT (EDA2R, TNFRSF27, XEDAR, Tumor necrosis factor receptor superfamily member 27, X-linked ectodysplasin-A2 receptor) (FITC)

Sign In for Pricing
View Details