Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8), Biotinylated

This Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombospondin type-1 domain-containing protein 8 THSD8

UniProt

A0A1W2PP97

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ALVYQDYQYLGQQGEGDSWEQLRLQHLKEVEDSILGPWGKWRCLCDLGKQERSREVVGTAPGPVFMDPEKLIQLRPCRQRDCPSCKPFDCDWRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal alpha 1B-Glycoprotein Antibody
NBP2-33419-25ul 25 µL

Rabbit Polyclonal alpha 1B-Glycoprotein Antibody

Sign In for Pricing
View Details
ATP5JL (ATP Synthase f Chain Mitochondrial, ATP5JL, ATPK) (MaxLight 405) discontinued
302280-ML405 100 µL

ATP5JL (ATP Synthase f Chain Mitochondrial, ATP5JL, ATPK) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rat Yipf4 Pre-designed siRNA Set B
SI216103B 1 Each

Rat Yipf4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA313441 100 µL

beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANXA9 Polyclonal Antibody, HRP Conjugated
A55712-050 50 µL

ANXA9 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Slc3a2 (NM_001161413) Mouse Tagged Lenti ORF Clone
MR226097L4 10 µg

Slc3a2 (NM_001161413) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details