Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf90 (CHO90), Biotinylated

This Recombinant Human Uncharacterized protein C8orf90 (CHO90), Biotinylated spans the amino acid sequence from region 1-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C8orf90 C8orf90

UniProt

A0A2R8Y2Y2

Expression Region

1-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASSCPGTPSPAGLPPPSVATPGETLGPAAPPEPAFPDIYGGDAQLWEAHFRGIGRAYRALGKQDDFAIRVLTENFTLPFPFAWPPGSDPACGPLFYDPRDRADFDFLLRGPGASPPALLRPLHATAQAAMRKRRLERLALSCARARGPGPASSCCCPAPPPPSRSPRPALPATAPPGWPRPRRCPESEQNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKR (PRKR) Antibody (Y27) Blocking peptide
orb1445319 500 µg

PKR (PRKR) Antibody (Y27) Blocking peptide

Sign In for Pricing
View Details
Entinostat discontinued. See M4693-15A
274839-01 25 mg

Entinostat discontinued. See M4693-15A

Sign In for Pricing
View Details
Entinostat discontinued. See M4693-15A
274839-02 50 mg

Entinostat discontinued. See M4693-15A

Sign In for Pricing
View Details
Entinostat discontinued. See M4693-15A
274839-03 100 mg

Entinostat discontinued. See M4693-15A

Sign In for Pricing
View Details
Entinostat discontinued. See M4693-15A
274839-04 250 mg

Entinostat discontinued. See M4693-15A

Sign In for Pricing
View Details
Entinostat discontinued. See M4693-15A
274839-05 500 mg

Entinostat discontinued. See M4693-15A

Sign In for Pricing
View Details