Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ), Biotinylated

This Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ), Biotinylated spans the amino acid sequence from region 16-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretory calcium-binding phosphoprotein proline-glutamine rich 1 SCPPPQ1

UniProt

A0A411D538

Expression Region

16-79

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPIPLEQYAESSSEQRFIFYPPQVPPFFPQVLFPLPPQPPLVLTPNDLIALLIAILNQLGILFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA6 Antibody
A43724-50UL 50 μL

NDUFA6 Antibody

Sign In for Pricing
View Details
A-Kinase Anchor Protein 10, Mitochondrial (AKAP10) Antibody
abx133852-01 30 µL

A-Kinase Anchor Protein 10, Mitochondrial (AKAP10) Antibody

Sign In for Pricing
View Details
A-Kinase Anchor Protein 10, Mitochondrial (AKAP10) Antibody
abx133852-02 100 µL

A-Kinase Anchor Protein 10, Mitochondrial (AKAP10) Antibody

Sign In for Pricing
View Details
A-Kinase Anchor Protein 10, Mitochondrial (AKAP10) Antibody
abx133852-03 200 µL

A-Kinase Anchor Protein 10, Mitochondrial (AKAP10) Antibody

Sign In for Pricing
View Details
Mouse/Rat FABP1/L-FABP Quantikine ELISA Kit
RFBP10 96 Tests

Mouse/Rat FABP1/L-FABP Quantikine ELISA Kit

Sign In for Pricing
View Details
P63-α Mouse Monoclonal Antibody (3F11)
E12-767 100 µg -100 µL

P63-α Mouse Monoclonal Antibody (3F11)

Sign In for Pricing
View Details