Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP), Biotinylated

This Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP), Biotinylated spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor gamma alternate reading frame protein; TARP; TRGC1

UniProt

A2JGV3

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQMFPPSPLFFFLQLLKQSSRRLEHTFVFLRNFSLMLLRYIGKKRRATRFWDPRRGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glut2 Antibody
E19-7510-2 100 µg -100 µL

Glut2 Antibody

Sign In for Pricing
View Details
Human ALCAM (Activated Leukocyte Cell Adhesion Molecule) Microsample ELISA Kit
orb2999414-01 48 Tests

Human ALCAM (Activated Leukocyte Cell Adhesion Molecule) Microsample ELISA Kit

Sign In for Pricing
View Details
Human ALCAM (Activated Leukocyte Cell Adhesion Molecule) Microsample ELISA Kit
orb2999414-02 96 Tests

Human ALCAM (Activated Leukocyte Cell Adhesion Molecule) Microsample ELISA Kit

Sign In for Pricing
View Details
Jade3 Mouse siRNA Oligo Duplex (Locus ID 382207)
SR420420 1 Kit

Jade3 Mouse siRNA Oligo Duplex (Locus ID 382207)

Sign In for Pricing
View Details
Transcription factor SOX-2 SOX2/SOX Rabbit Polyclonal Antibody (Cy3)
orb2574359 100 µg

Transcription factor SOX-2 SOX2/SOX Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
CREB3L4 Peptide
45-428P 0.1 mg

CREB3L4 Peptide

Sign In for Pricing
View Details