Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein encoded by LINC01387 (CR064), Biotinylated

This Recombinant Human Putative uncharacterized protein encoded by LINC01387 (CR064), Biotinylated spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein encoded by LINC01387 LINC01387 C18orf64

UniProt

J3KSC0

Expression Region

1-135

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPAPPFLGVLENPVPQWDLSILGSIRIRVSHTEVQGSGSSRSPEALRKESLEVEWTLVLLAIPPRIQPSQQDGGPPKCCDLLRAALLGRHCPLCVPAGEVFSQKRDNEQDRSEFIGQTLKLLVKRNVSLELSCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62L (L-Selectin) (CD62L/1588), 0.2mg/mL
BNUB1588-100 1x 100 µL

CD62L (L-Selectin) (CD62L/1588), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Rat HepaCAM2 Protein (Fc Tag)
PKSR030295 100 µg

Recombinant Rat HepaCAM2 Protein (Fc Tag)

Sign In for Pricing
View Details
TGIF (TGIF1) (Center) Rabbit Polyclonal Antibody
AP54235PU-N 400 µL

TGIF (TGIF1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KChIP2 (KCNIP2) (NM_014591) Human Recombinant Protein
TP313131 20 µg

KChIP2 (KCNIP2) (NM_014591) Human Recombinant Protein

Sign In for Pricing
View Details
2,4,6-Tribromobenzyl Bromide
TRC-T767855-250MG 250 mg

2,4,6-Tribromobenzyl Bromide

Sign In for Pricing
View Details
RBM42 (C-term) Rabbit Polyclonal Antibody
AP53610PU-N 400 µL

RBM42 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details