Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1), Biotinylated

This Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1), Biotinylated spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 1 SMIM10L1

UniProt

P0DMW3

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAMTP1 ORF Vector (Human) (pORF)
ORF019993 1.0 µg DNA

GAMTP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
(3-Ethynylphenyl) methanol
KAA60207-01 100 mg

(3-Ethynylphenyl) methanol

Sign In for Pricing
View Details
(3-Ethynylphenyl) methanol
KAA60207-02 1 g

(3-Ethynylphenyl) methanol

Sign In for Pricing
View Details
Entpd4 siRNA Oligos set (Mouse)
19324174 3x 5 nmol

Entpd4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Slc6a3 (NM_012694) Rat Tagged Lenti ORF Clone
RR210023L4 10 µg

Slc6a3 (NM_012694) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mapk11 (NM_011161) Mouse Tagged Lenti ORF Clone
MR205607L3 10 µg

Mapk11 (NM_011161) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details