Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM236C (F236C), Biotinylated

This Recombinant Human Protein FAM236C (F236C), Biotinylated spans the amino acid sequence from region 1-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM236C FAM236C

UniProt

P0DP71

Expression Region

1-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIFTPFLPPADLSVFQNVKGPQKDPEELVAVSDTAEDPSSGTGLPREPALLRGSWRSRFQRALACFIKCFRGGYRALGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR82P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV789939 1.0 µg DNA

WDR82P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CD90 / Thy1 (Mouse) (Stromal / Mesenchymal Marker) Antibody - With BSA and Azide
orb1462794-01 20 µg

CD90 / Thy1 (Mouse) (Stromal / Mesenchymal Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
CD90 / Thy1 (Mouse) (Stromal / Mesenchymal Marker) Antibody - With BSA and Azide
orb1462794-02 100 µg

CD90 / Thy1 (Mouse) (Stromal / Mesenchymal Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
LRRC31 siRNA (Human)
CRJ2559-01 15 nmol

LRRC31 siRNA (Human)

Sign In for Pricing
View Details
LRRC31 siRNA (Human)
CRJ2559-02 30 nmol

LRRC31 siRNA (Human)

Sign In for Pricing
View Details
Anti-CYLD Antibody
E38A6612 100 µg -100 µL

Anti-CYLD Antibody

Sign In for Pricing
View Details