Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated

This Recombinant Human Late cornified envelope protein 7A (LCE7A), Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imbricatolic acid
380493 5 mg

Imbricatolic acid

Sign In for Pricing
View Details
cyclin D1 Lentiviral Activation Particles (h)
sc-400047-LAC 200 µL

cyclin D1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Trimethoprim discontinued
T8487-03 1 mg

Trimethoprim discontinued

Sign In for Pricing
View Details
CDH23 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
15664154 3x 1.0 µg DNA

CDH23 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Human MMP7 (Matrix Metalloproteinase 7) Microsample ELISA Kit
ELK10214MS-01 48 Tests

Human MMP7 (Matrix Metalloproteinase 7) Microsample ELISA Kit

Sign In for Pricing
View Details
Human MMP7 (Matrix Metalloproteinase 7) Microsample ELISA Kit
ELK10214MS-02 96 Tests

Human MMP7 (Matrix Metalloproteinase 7) Microsample ELISA Kit

Sign In for Pricing
View Details