Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog A (ETDA), Biotinylated

This Recombinant Human Embryonic testis differentiation protein homolog A (ETDA), Biotinylated spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog A ETDA

UniProt

Q3ZM63

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-100 1x 100 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF488A conjugate, 0.1mg/mL
BNC881731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), 0.2mg/mL
BNUB0017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), 0.2mg/mL

Sign In for Pricing
View Details
VEGF-A (VEGF/1063), CF568 conjugate, 0.1mg/mL
BNC681063-500 1x 500 µL

VEGF-A (VEGF/1063), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF594 conjugate, 0.1mg/mL
BNC941532-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details