Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog A (ETDA), Biotinylated

This Recombinant Human Embryonic testis differentiation protein homolog A (ETDA), Biotinylated spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog A ETDA

UniProt

Q3ZM63

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant African Swine Fever Virus Minor Capsid Protein M1249L, N-His
VG9C251-01 1 mg

Recombinant African Swine Fever Virus Minor Capsid Protein M1249L, N-His

Sign In for Pricing
View Details
Recombinant African Swine Fever Virus Minor Capsid Protein M1249L, N-His
VG9C251-02 100 µg

Recombinant African Swine Fever Virus Minor Capsid Protein M1249L, N-His

Sign In for Pricing
View Details
RNF31 3'UTR Luciferase Stable Cell Line
TU020042 1.0 mL

RNF31 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Enterovirus Panel
PH2001875-01 24 Reactions

Enterovirus Panel

Sign In for Pricing
View Details
Enterovirus Panel
PH2001875-02 24 Reactions

Enterovirus Panel

Sign In for Pricing
View Details
SV2C Protein Vector (Rat) (pPM-C-HA)
PV309068 500 ng

SV2C Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details