Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Negative regulator of P-body association (NBDY)

This Recombinant Human Negative regulator of P-body association (NBDY) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Negative regulator of P-body association; P-body dissociating protein; Protein NoBody; NBDY LINC01420

UniProt

A0A0U1RRE5

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA1, NT (PNPLA1, Patatin-like phospholipase domain-containing protein 1) (MaxLight 490) discontinued
040222-ML490 100 µL

PNPLA1, NT (PNPLA1, Patatin-like phospholipase domain-containing protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
MOS (NM_005372) Human Over-expression Lysate
LC417350 20 µg

MOS (NM_005372) Human Over-expression Lysate

Sign In for Pricing
View Details
PIN1 CRISPR Knock Out 293T Cell Line (Human)
36699141 1x 10^6 Cells / 1.0 mL

PIN1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
PFTK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1632206 1.0 µg DNA

PFTK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Fish Glutaredoxin 3 ELISA Kit
MBS079090 Inquire

Fish Glutaredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Sp4 Lentiviral Activation Particles (m2)
sc-423098-LAC-2 200 µL

Sp4 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details