Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyw1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6107104 1.0 µg DNA

Tyw1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-ALDH3A1 Rabbit Monoclonal Antibody
MA1141-.05 50 µL

Anti-ALDH3A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CK14+17+42+10 Rabbit Polyclonal Antibody (AP)
orb1605335 100 µL

CK14+17+42+10 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
1,1,1-Triethoxy-3-methoxypropane
PDA60927-01 50 mg

1,1,1-Triethoxy-3-methoxypropane

Sign In for Pricing
View Details
1,1,1-Triethoxy-3-methoxypropane
PDA60927-02 0.5 g

1,1,1-Triethoxy-3-methoxypropane

Sign In for Pricing
View Details
Mouse Gliadin IgA ELISA Kit
EIA05729m 1 Kit

Mouse Gliadin IgA ELISA Kit

Sign In for Pricing
View Details