Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Importin subunit alpha-5 (FITC)
320398-01 50 µg

Importin subunit alpha-5 (FITC)

Sign In for Pricing
View Details
Importin subunit alpha-5 (FITC)
320398-02 100 µg

Importin subunit alpha-5 (FITC)

Sign In for Pricing
View Details
Recombinant Mouse Sirtuin 3 (SIRT3)
RPU51870-01 50 µg

Recombinant Mouse Sirtuin 3 (SIRT3)

Sign In for Pricing
View Details
Recombinant Mouse Sirtuin 3 (SIRT3)
RPU51870-02 100 µg

Recombinant Mouse Sirtuin 3 (SIRT3)

Sign In for Pricing
View Details
Recombinant Mouse Sirtuin 3 (SIRT3)
RPU51870-03 1 mg

Recombinant Mouse Sirtuin 3 (SIRT3)

Sign In for Pricing
View Details
Z-piperazine-2-carboxylic acid ≥96% (HPLC)
242911-01 1 g

Z-piperazine-2-carboxylic acid ≥96% (HPLC)

Sign In for Pricing
View Details