Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RACK1 Rabbit Monoclonal Antibody [Clone ID: 23GB2355]
TA425177 100 µL

RACK1 Rabbit Monoclonal Antibody [Clone ID: 23GB2355]

Sign In for Pricing
View Details
Fam174a (NM_026321) Mouse Tagged ORF Clone
MG201804 10 µg

Fam174a (NM_026321) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IKZF3 (NM_183231) Human Recombinant Protein
TP319750L 1 mg

IKZF3 (NM_183231) Human Recombinant Protein

Sign In for Pricing
View Details
IKK-β (Ab-188) Antibody
8B0442-AAT 50 µg

IKK-β (Ab-188) Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS639763 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Benzene-d5-ethanamine Hydrochloride
TRC-B188857-50MG 50 mg

Benzene-d5-ethanamine Hydrochloride

Sign In for Pricing
View Details