Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF640R conjugate, 0.1mg/mL
BNC401461-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB519650 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
Iron(III) Oxide
TRC-I775210-5G 5 g

Iron(III) Oxide

Sign In for Pricing
View Details
Benzyl 2,2,2-Trifluoroethyl Sulphide
TRC-B130033-50MG 50 mg

Benzyl 2,2,2-Trifluoroethyl Sulphide

Sign In for Pricing
View Details
GPR103 (QRFPR) (NM_198179) Human Over-expression Lysate
LC403681 20 µg

GPR103 (QRFPR) (NM_198179) Human Over-expression Lysate

Sign In for Pricing
View Details
GSK3 beta (GSK3B) (NM_002093) Human Over-expression Lysate
LY419542 100 µg

GSK3 beta (GSK3B) (NM_002093) Human Over-expression Lysate

Sign In for Pricing
View Details