Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial

This Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial spans the amino acid sequence from region 35-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neural cell adhesion molecule L1-like protein; Close homolog of L1; [Cleaved into: Processed neural cell adhesion molecule L1-like protein] CHL1 CALL

UniProt

O00533

Expression Region

35-124

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700006E09Rik (NM_029287) Mouse Tagged ORF Clone
MR214128 10 µg

1700006E09Rik (NM_029287) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TMOD2 Conjugated Antibody
C45264 100 µL

TMOD2 Conjugated Antibody

Sign In for Pricing
View Details
NOP56 Rabbit Polyclonal Antibody
orb327351 100 µL

NOP56 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 15 Antibody (KRT15/8312R) [DyLight 680]
NBP3-24320FR 0.1 mL

Rabbit Monoclonal Cytokeratin 15 Antibody (KRT15/8312R) [DyLight 680]

Sign In for Pricing
View Details
SMAD1 + SMAD5 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-2973R-PE-Cy5.5 100 µL

SMAD1 + SMAD5 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
RTKN2 Antibody, Biotin conjugated
A60899-50UG 50 µg

RTKN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details