Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-opiomelanocortin (COLI), partial

This Recombinant Human Pro-opiomelanocortin (COLI), partial spans the amino acid sequence from region 237-267. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-opiomelanocortin; POMC; Corticotropin-lipotropin; [Cleaved into: NPP; Melanotropin gamma; Gamma-MSH; Potential peptide; Corticotropin; Adrenocorticotropic hormone; ACTH; Melanocyte-stimulating hormone alpha; Alpha-MSH; Melanotropin alpha; Corticotropin-like intermediary peptide; CLIP; Lipotropin beta; Beta-LPH; Lipotropin gamma; Gamma-LPH; Melanocyte-stimulating hormone beta; Beta-MSH; Melanotropin beta; Beta-endorphin; Met-enkephalin] POMC

UniProt

P01189

Expression Region

237-267

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPHK2 (NM_020126) Human Tagged ORF Clone Lentiviral Particle
RC203019L3V 200 µL

SPHK2 (NM_020126) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor Receptor, C-MET/HGFR GENLISA ELISA
KLR2008 96 Well

Rat Hepatocyte Growth Factor Receptor, C-MET/HGFR GENLISA ELISA

Sign In for Pricing
View Details
Brain-derived neurotrophic factor
orb1643680-01 50 µg

Brain-derived neurotrophic factor

Sign In for Pricing
View Details
Brain-derived neurotrophic factor
orb1643680-02 100 µg

Brain-derived neurotrophic factor

Sign In for Pricing
View Details
Brain-derived neurotrophic factor
orb1643680-03 1 mg

Brain-derived neurotrophic factor

Sign In for Pricing
View Details
SEC13 Rabbit pAb
E47R19609 100 µL

SEC13 Rabbit pAb

Sign In for Pricing
View Details