Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Follitropin subunit beta (FSHB)

This Recombinant Human Follitropin subunit beta (FSHB) spans the amino acid sequence from region 19-129. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Follitropin subunit beta; Follicle-stimulating hormone beta subunit; FSH-B; FSH-beta; Follitropin beta chain; FSHB

UniProt

P01225

Expression Region

19-129

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Mouse IgG2a Isotype Control (M2AK) [Alexa Fluor 647]
NBP1-96981AF647 0.5 mL

Mouse Monoclonal Mouse IgG2a Isotype Control (M2AK) [Alexa Fluor 647]

Sign In for Pricing
View Details
Hyou1 ORF Vector (Rat) (pORF)
ORF068462 1.0 µg DNA

Hyou1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Cyclin-dependent kinase 7 Cdk7 Rabbit Polyclonal Antibody (Carrier-free)
orb3080465 100 µg

Cyclin-dependent kinase 7 Cdk7 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Polyclonal CBLN3 Antibody
APR11567G 0.1ml

Polyclonal CBLN3 Antibody

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody [Clone 1G6]
E45M12668V-2 50 µL

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone 1G6]

Sign In for Pricing
View Details
Gnetulin
CGA34024-01 1 mg

Gnetulin

Sign In for Pricing
View Details