Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myoglobin (MYG)

This Recombinant Human Myoglobin (MYG) spans the amino acid sequence from region 2-154. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myoglobin; Nitrite reductase MB; EC 1.7.-.-; Pseudoperoxidase MB; EC 1.11.1.-; MB

UniProt

P02144

Expression Region

2-154

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA/413), CF740 conjugate, 0.1mg/mL
BNC740413-100 1x 100 µL

Chromogranin A (CHGA/413), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR562456 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
GRSF1 Human Knockdown Lysate
LY300186 100 µg

GRSF1 Human Knockdown Lysate

Sign In for Pricing
View Details
IFluor® 555 TCO
1007-AAT 1 mg

IFluor® 555 TCO

Sign In for Pricing
View Details
CEACAM20 (NM_001102599) Human Over-expression Lysate
LY420168 100 µg

CEACAM20 (NM_001102599) Human Over-expression Lysate

Sign In for Pricing
View Details
FullRanger 100bp DNA Ladder
11800 100 Loads

FullRanger 100bp DNA Ladder

Sign In for Pricing
View Details