Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Major prion protein (PRIO)

This Recombinant Human Major prion protein (PRIO) spans the amino acid sequence from region 23-230. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major prion protein; PrP; ASCR; PrP27-30; PrP33-35C; CD antigen CD230; PRNP ALTPRP PRIP PRP

UniProt

P04156

Expression Region

23-230

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cyclin-Y, Ccny ELISA KIT
ELI-25235m 96 Tests

Mouse Cyclin-Y, Ccny ELISA KIT

Sign In for Pricing
View Details
LYSMD4, NT (LYSMD4, LysM and putative peptidoglycan-binding domain-containing protein 4) (MaxLight 405) discontinued
038036-ML405 100 µL

LYSMD4, NT (LYSMD4, LysM and putative peptidoglycan-binding domain-containing protein 4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Colostrum, Single Donor Human - 1st Day Breast Milk
MBS170308-01 1 mL

Colostrum, Single Donor Human - 1st Day Breast Milk

Sign In for Pricing
View Details
Colostrum, Single Donor Human - 1st Day Breast Milk
MBS170308-02 5 mL

Colostrum, Single Donor Human - 1st Day Breast Milk

Sign In for Pricing
View Details
Colostrum, Single Donor Human - 1st Day Breast Milk
MBS170308-03 25 mL

Colostrum, Single Donor Human - 1st Day Breast Milk

Sign In for Pricing
View Details
Colostrum, Single Donor Human - 1st Day Breast Milk
MBS170308-04 5x 25 mL

Colostrum, Single Donor Human - 1st Day Breast Milk

Sign In for Pricing
View Details