Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-B (S100B)

This Recombinant Human Protein S100-B (S100B) spans the amino acid sequence from region 2-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100B

UniProt

P04271

Expression Region

2-92

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (HRP)
130472-HRP 100 µL

NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (HRP)

Sign In for Pricing
View Details
Anti-P2RY5/LPAR6 Antibody Picoband® Fluoro647 Conjugated
A05725-1-Fluoro647 100 µg/Vial

Anti-P2RY5/LPAR6 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
BCL10 Antibody
orb2644270 100 µg

BCL10 Antibody

Sign In for Pricing
View Details
HMGB1 (High Mobility Group Protein B1, DKFZp686A04236, HMG1, HMG3, SBP-1) (FITC)
MBS6421010-01 0.1 mL

HMGB1 (High Mobility Group Protein B1, DKFZp686A04236, HMG1, HMG3, SBP-1) (FITC)

Sign In for Pricing
View Details
HMGB1 (High Mobility Group Protein B1, DKFZp686A04236, HMG1, HMG3, SBP-1) (FITC)
MBS6421010-02 5x 0.1 mL

HMGB1 (High Mobility Group Protein B1, DKFZp686A04236, HMG1, HMG3, SBP-1) (FITC)

Sign In for Pricing
View Details
SR protein repeat Rabbit Monoclonal Antibody
orb866814 100 µL

SR protein repeat Rabbit Monoclonal Antibody

Sign In for Pricing
View Details