Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sex hormone-binding globulin (SHBG)

This Recombinant Human Sex hormone-binding globulin (SHBG) spans the amino acid sequence from region 30-402. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sex hormone-binding globulin; SHBG; Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin; SHBG

UniProt

P04278

Expression Region

30-402

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRORP shRNA (UAS) - Lentiviral human PRORP shRNA (UAS, iRFP) plasmid
GTR15319603 1 Vial

Lentiviral human PRORP shRNA (UAS) - Lentiviral human PRORP shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
AcalephFluor®488 Conjugation Kit
CRG1052-01 1 mg

AcalephFluor®488 Conjugation Kit

Sign In for Pricing
View Details
AcalephFluor®488 Conjugation Kit
CRG1052-02 5 mg

AcalephFluor®488 Conjugation Kit

Sign In for Pricing
View Details
ADRB2 (T384) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 550)
MBS6461815-01 0.1 mL

ADRB2 (T384) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 550)

Sign In for Pricing
View Details
ADRB2 (T384) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 550)
MBS6461815-02 5x 0.1 mL

ADRB2 (T384) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (MaxLight 550)

Sign In for Pricing
View Details
C3orf65 CRISPR Knock Out 293T Cell Line (Human)
14498141 1x 10^6 Cells / 1.0 mL

C3orf65 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details