Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin alpha chain (INHA)

This Recombinant Human Inhibin alpha chain (INHA) spans the amino acid sequence from region 233-366. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inhibin alpha chain INHA

UniProt

P05111

Expression Region

233-366

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc7a8 Mouse shRNA Plasmid (Locus ID 50934)
TL502853 1 Kit

Slc7a8 Mouse shRNA Plasmid (Locus ID 50934)

Sign In for Pricing
View Details
FEN1 Antibody Blocking Peptide
orb1500164 500 µg

FEN1 Antibody Blocking Peptide

Sign In for Pricing
View Details
L-erythro-4-Fluoroisoglutamine
PC6923 1 Each

L-erythro-4-Fluoroisoglutamine

Sign In for Pricing
View Details
Sheep anti Human C4 binding protein
MBS573395-01 1 mL

Sheep anti Human C4 binding protein

Sign In for Pricing
View Details
Sheep anti Human C4 binding protein
MBS573395-02 5x 1 mL

Sheep anti Human C4 binding protein

Sign In for Pricing
View Details
PE Rabbit anti-Mouse IL-10RA/CD210 mAb
A26641-01 50 Tests

PE Rabbit anti-Mouse IL-10RA/CD210 mAb

Sign In for Pricing
View Details