Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, heart (FABPH)

This Recombinant Human Fatty acid-binding protein, heart (FABPH) spans the amino acid sequence from region 2-133. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; FABP3 FABP11 MDGI

UniProt

P05413

Expression Region

2-133

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
CF806338 100 µg

Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI1C6]

Sign In for Pricing
View Details
1-Propylpiperazine Dihydrobromide
TRC-P838518-500MG 500 mg

1-Propylpiperazine Dihydrobromide

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS634632 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), 1mg/mL
BNUM0844-50 1x 50 µL

Cytokeratin 10 (KRT10/844), 1mg/mL

Sign In for Pricing
View Details
TRAIL Recombinant Rabbit monoclonal Antibody
HA723634 100 µL

TRAIL Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
8-Bromoxanthine
TRC-B689180-2.5G 2.5 g

8-Bromoxanthine

Sign In for Pricing
View Details