Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, heart (FABPH)

This Recombinant Human Fatty acid-binding protein, heart (FABPH) spans the amino acid sequence from region 2-133. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; FABP3 FABP11 MDGI

UniProt

P05413

Expression Region

2-133

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C11orf54 activation kit by CRISPRa
GA109178 1 Kit

Human C11orf54 activation kit by CRISPRa

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF594 conjugate, 0.1mg/mL
BNC943124-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Human HLA-DP Antibody[B7/21]
AN00566D-01 20 Tests

PE Anti-Human HLA-DP Antibody[B7/21]

Sign In for Pricing
View Details
PE Anti-Human HLA-DP Antibody[B7/21]
AN00566D-02 100 Tests

PE Anti-Human HLA-DP Antibody[B7/21]

Sign In for Pricing
View Details
PE Anti-Human HLA-DP Antibody[B7/21]
AN00566D-03 2x 100 Tests

PE Anti-Human HLA-DP Antibody[B7/21]

Sign In for Pricing
View Details
Zfp143 Mouse Gene Knockout Kit (CRISPR)
KN519734 1 Kit

Zfp143 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details