Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPAC1 (V371) polyclonal antibody
BS3211 50ul

VPAC1 (V371) polyclonal antibody

Sign In for Pricing
View Details
Epi-gamma-Cyhalothrin-d5
164026 1 mg

Epi-gamma-Cyhalothrin-d5

Sign In for Pricing
View Details
IGKV1-33 3'UTR Luciferase Stable Cell Line
TU010791 1.0 mL

IGKV1-33 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
OCLN Antibody (C-term) Blocking peptide
MBS9220285-01 0.5 mg

OCLN Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
OCLN Antibody (C-term) Blocking peptide
MBS9220285-02 5x 0.5 mg

OCLN Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Hydrazone structures NO.3
JH917338 1 Each

Hydrazone structures NO.3

Sign In for Pricing
View Details