Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human M1-specific T cell receptor alpha chain (TRAR1), partial

This Recombinant Human M1-specific T cell receptor alpha chain (TRAR1), partial spans the amino acid sequence from region 20-243. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M1-specific T cell receptor alpha chain; TR alpha chain TRAV27*01J42*01C*01; TRA

UniProt

P0DSE1

Expression Region

20-243

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGGGSQGNLIFGKGTKLSVKPIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Threonine-15N
TRC-T405563-10MG 10 mg

L-Threonine-15N

Sign In for Pricing
View Details
Human SUSD1 activation kit by CRISPRa
GA112071 1 Kit

Human SUSD1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD79a (IGA/764), CF640R conjugate, 0.1mg/mL
BNC400764-500 1x 500 µL

CD79a (IGA/764), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuicKey Pro Rat ApoH (Apolipoprotein H) ELISA Kit
E-OSEL-R0013-01 24 Tests

QuicKey Pro Rat ApoH (Apolipoprotein H) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rat ApoH (Apolipoprotein H) ELISA Kit
E-OSEL-R0013-02 48 Tests

QuicKey Pro Rat ApoH (Apolipoprotein H) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rat ApoH (Apolipoprotein H) ELISA Kit
E-OSEL-R0013-03 96 Tests

QuicKey Pro Rat ApoH (Apolipoprotein H) ELISA Kit

Sign In for Pricing
View Details