Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-amylase 1C (AMY1C)

This Recombinant Human Alpha-amylase 1C (AMY1C) spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-amylase 1C; EC 3.2.1.1; AMY1C AMY1

UniProt

P0DTE8

Expression Region

16-511

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-500 1x 500 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-100 1x 100 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-500 1x 500 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details