Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Laminin subunit gamma-1 (LAMC1), partial

This Recombinant Human Laminin subunit gamma-1 (LAMC1), partial spans the amino acid sequence from region 46-285. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Laminin subunit gamma-1; Laminin B2 chain; Laminin-1 subunit gamma; Laminin-10 subunit gamma; Laminin-11 subunit gamma; Laminin-2 subunit gamma; Laminin-3 subunit gamma; Laminin-4 subunit gamma; Laminin-6 subunit gamma; Laminin-7 subunit gamma; Laminin-8 subunit gamma; Laminin-9 subunit gamma; S-laminin subunit gamma; S-LAM gamma; LAMC1 LAMB2

UniProt

P11047

Expression Region

46-285

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPQRCMPEFVNAAFNVTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL
BNC740045-100 1x 100 µL

Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562136 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
YIF1B Rabbit Polyclonal Antibody
TA361745 100 µL

YIF1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Srsf5 Mouse Gene Knockout Kit (CRISPR)
KN516747 1 Kit

Srsf5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-FOXO3a (S253) Recombinant Rabbit Monoclonal Antibody [ST49-01]
ET1609-49 100 µL

Phospho-FOXO3a (S253) Recombinant Rabbit Monoclonal Antibody [ST49-01]

Sign In for Pricing
View Details
RAGE (AGER) (NM_001136) Human Over-expression Lysate
LY400460 100 µg

RAGE (AGER) (NM_001136) Human Over-expression Lysate

Sign In for Pricing
View Details