Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycogen phosphorylase, muscle form (PYGM), partial

This Recombinant Human Glycogen phosphorylase, muscle form (PYGM), partial spans the amino acid sequence from region 2-501. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycogen phosphorylase, muscle form; EC 2.4.1.1; Myophosphorylase; PYGM

UniProt

P11217

Expression Region

2-501

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANXA5 (Annexin A5) ELISA Kit
RE1236H-01 48 Tests

Human ANXA5 (Annexin A5) ELISA Kit

Sign In for Pricing
View Details
Human ANXA5 (Annexin A5) ELISA Kit
RE1236H-02 96 Tests

Human ANXA5 (Annexin A5) ELISA Kit

Sign In for Pricing
View Details
Vacuole membrane protein 1
orb1635667-01 50 µg

Vacuole membrane protein 1

Sign In for Pricing
View Details
Vacuole membrane protein 1
orb1635667-02 100 µg

Vacuole membrane protein 1

Sign In for Pricing
View Details
Vacuole membrane protein 1
orb1635667-03 1 mg

Vacuole membrane protein 1

Sign In for Pricing
View Details
Recombinant Human ERP29 Protein, His (Fc)-Avi-tagged
ERP29-866H 50 µg

Recombinant Human ERP29 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details