Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (CNRG)

This Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (CNRG) spans the amino acid sequence from region 1-87. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma; GMP-PDE gamma; EC 3.1.4.35; PDE6G PDEG

UniProt

P18545

Expression Region

1-87

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2), CF568 conjugate, 0.1mg/mL
BNC680056-500 1x 500 µL

CD74 (LN-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (C86/1146), CF740 conjugate, 0.1mg/mL
BNC741146-500 1x 500 µL

CD86 (C86/1146), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF740 conjugate, 0.1mg/mL
BNC742868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF740 conjugate, 0.1mg/mL
BNC741194-100 1x 100 µL

EGFR (31G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details