Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-adrenomedullin (ADML), partial

This Recombinant Human Pro-adrenomedullin (ADML), partial spans the amino acid sequence from region 95-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20] ADM AM

UniProt

P35318

Expression Region

95-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf104 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV811036 1.0 µg DNA

C14orf104 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PerCP Anti-human CD21 Antibody *HI21a*
102101T0-AAT 25 Tests

PerCP Anti-human CD21 Antibody *HI21a*

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF318 Antibody [PE]
NB100-77289PE 0.1 mL

Rabbit Polyclonal ZNF318 Antibody [PE]

Sign In for Pricing
View Details
FITC Anti-human CD172 Antibody *B4B6*
117211G1-AAT 500 Tests

FITC Anti-human CD172 Antibody *B4B6*

Sign In for Pricing
View Details
4931440F15Rik Protein Vector (Mouse) (pPB-N-His)
PV149567 500 ng

4931440F15Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal Mouse anti-Human IgG Fc Secondary Antibody (MK 1 A6) [Janelia Fluor 549]
NBP2-68464JF549 0.2 mL

Mouse Monoclonal Mouse anti-Human IgG Fc Secondary Antibody (MK 1 A6) [Janelia Fluor 549]

Sign In for Pricing
View Details