Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hypothetical protein LOC283129 antibody
23180 100 µL

Hypothetical protein LOC283129 antibody

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Pentatricopeptide repeat-containing protein At1g32415, mitochondrial (PCMP-E56) , partial
MBS1155349 Inquire

Recombinant Arabidopsis thaliana Pentatricopeptide repeat-containing protein At1g32415, mitochondrial (PCMP-E56) , partial

Sign In for Pricing
View Details
MARCH6 (Membrane-Associated Ring Finger (C3HC4) 6, KIAA0597, MARCH-VI, RNF176, TEB4) (MaxLight 405) discontinued
248540-ML405 100 µL

MARCH6 (Membrane-Associated Ring Finger (C3HC4) 6, KIAA0597, MARCH-VI, RNF176, TEB4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Gprin2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3295903 1.0 µg DNA

Gprin2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CHIKV Spike glycoprotein E2 Human Monoclonal Antibody
orb2961005-01 50 µg

CHIKV Spike glycoprotein E2 Human Monoclonal Antibody

Sign In for Pricing
View Details
CHIKV Spike glycoprotein E2 Human Monoclonal Antibody
orb2961005-02 100 µg

CHIKV Spike glycoprotein E2 Human Monoclonal Antibody

Sign In for Pricing
View Details